PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_152_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family EIL
Protein Properties Length: 534aa    MW: 59844.5 Da    PI: 6.0942
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_152_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN368.61.8e-2134111186
                   XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
          EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpveg 86 
                   e+l krm  d+ ++++lke+++      e+    ++s+ ++e++rrkk+ raQD+iLkYM+k+me+c+aq fvY i+pe gkp +g
  Neem_152_f_1  34 EDLMKRMGGDRKRMQKLKEKRNA----DEH----AESSARQEASRRKKILRAQDSILKYMVKIMEICKAQRFVYRIVPERGKPAQG 111
                   7999***********99998886....233....456789*******************************************865 PP

2EIN3284.73.5e-8710930569281
                   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TT CS
          EIN3  69 aqGfvYgiipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfple 165
                   aqGfvY i+pe gkpv+g+sdsLr+WWke v+fd+n+p ai++   + l  +++++    r+s  h+l elqDTtlgSLLsa mqhc+ppq +fple
  Neem_152_f_1 109 AQGFVYRIVPERGKPVTGSSDSLREWWKESVKFDQNAPLAITEF-MAPLFEEHGEH---GRNSLMHMLYELQDTTLGSLLSAPMQHCTPPQLKFPLE 201
                   8*****************************************98.33344333333...59************************************ PP

                   T--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXX CS
          EIN3 166 kgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsa 262
                   +g++pPWWPtGke+w ge+g+s++qg+ppy kphdlkkawkvsvL++vikhmsp+++++r+l+ qsk lq+km+akes ++++v++qee++++  + 
  Neem_152_f_1 202 RGLAPPWWPTGKEAWSGEQGVSTEQGPPPYSKPHDLKKAWKVSVLASVIKHMSPDLNRMRRLVQQSKGLQHKMTAKESYTWSKVVKQEEALMQLTKK 298
                   *****************************************************************************************98853333 PP

                   XXXXXXXXXXXXXXXXXXX CS
          EIN3 263 hssslrkqspkvtlsceqk 281
                     +             ++k
  Neem_152_f_1 299 CLNI------------SSK 305
                   3221............111 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048736.8E-2034110No hitNo description
PfamPF048732.7E-86109290No hitNo description
Gene3DG3DSA:1.10.3180.109.1E-62165295IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.4E-54169293IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MVEIYGEEVD PMSPGGEDQG DDDGEDEREE ISYEDLMKRM GGDRKRMQKL KEKRNADEHA  60
ESSARQEASR RKKILRAQDS ILKYMVKIME ICKAQRFVYR IVPERGKPAQ GFVYRIVPER  120
GKPVTGSSDS LREWWKESVK FDQNAPLAIT EFMAPLFEEH GEHGRNSLMH MLYELQDTTL  180
GSLLSAPMQH CTPPQLKFPL ERGLAPPWWP TGKEAWSGEQ GVSTEQGPPP YSKPHDLKKA  240
WKVSVLASVI KHMSPDLNRM RRLVQQSKGL QHKMTAKESY TWSKVVKQEE ALMQLTKKCL  300
NISSKYNENK NEEEAAIPDQ EKTVYVPVGG YKSDGGEKRQ CVFECEVAED MMYSFPNTRC  360
PQSQLGLDLW TKIPGVTMSL TALIGRGKVI TATGTQRQRR AQGRTHALAK TLPMYGYRTT  420
SSELMLLSGG SVDDFSVPRS LANWLNLEPA QVAGDGGDLV SEVGGASGGS STEGHGGYWG  480
RGIEDLGLDG AFDIQRSSLE VSNLRTGLKE EIAHDEATSV WDIGHEDHRD YESL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A7e-531672921126Protein ETHYLENE INSENSITIVE 3
4zds_B7e-531672921126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006464249.11e-174PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLV4SW511e-174V4SW51_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58792747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-107EIL family protein